PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn233951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 1042aa    MW: 115902 Da    PI: 9.3532
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn233951genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like64.12.5e-20222271151
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 k++++Wt+ LH++F+ea++++ G e+A Pk+ilelm+v+gLt+e+v+SHLQ
  Achn233951 222 KAKVVWTNALHNQFLEAIRSI-GLERAFPKKILELMNVPGLTRENVASHLQ 271
                 6799*****************.***************************** PP

2Response_reg82.81.1e-27231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l+vdD+ + + +++ +l++ +y ev ++++++eal +l+ k   +Dl+++D+ mp+m+G+el k+i+ee  klp+++++a ++e+ +l+ l+ Ga 
    Achn233951  23 ILVVDDDTTCLAIVAAILKSWKY-EVVTVKHASEALGTLRIKGgsFDLVVTDVHMPDMNGFELQKRIAEEF-KLPVVLMSADDKESVILKGLQNGAA 117
                   89*********************.***************666666************************99.************************* PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                    f++Kp++p++l +
    Achn233951 118 FFIVKPISPNDLKN 131
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.1E-3512137No hitNo description
SuperFamilySSF521726.26E-3219143IPR011006CheY-like superfamily
SMARTSM004486.7E-2921133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011037.3222137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2323131IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.98E-2724136No hitNo description
SuperFamilySSF466891.97E-14219274IPR009057Homeodomain-like
PROSITE profilePS512949.531219278IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-20220271IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-20222275IPR006447Myb domain, plants
Gene3DG3DSA:3.30.70.3306.6E-18712787IPR012677Nucleotide-binding alpha-beta plait domain
CDDcd122346.58E-41713783No hitNo description
PROSITE profilePS5010216.193713785IPR000504RNA recognition motif domain
SuperFamilySSF549281.29E-33713881IPR012677Nucleotide-binding alpha-beta plait domain
SMARTSM003607.1E-16714781IPR000504RNA recognition motif domain
PfamPF000762.3E-13715773IPR000504RNA recognition motif domain
Gene3DG3DSA:3.30.70.3303.1E-19791883IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010215.596806877IPR000504RNA recognition motif domain
SMARTSM003601.1E-17807873IPR000504RNA recognition motif domain
CDDcd124669.48E-40807876No hitNo description
PfamPF000762.5E-13808870IPR000504RNA recognition motif domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0000166Molecular Functionnucleotide binding
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1042 aa     Download sequence    Send to blast
MAVEMDASSQ SSQTSNPFGS ISILVVDDDT TCLAIVAAIL KSWKYEVVTV KHASEALGTL  60
RIKGGSFDLV VTDVHMPDMN GFELQKRIAE EFKLPVVLMS ADDKESVILK GLQNGAAFFI  120
VKPISPNDLK NLWQYAVGKK KKTKVVIEEI GNIQETSQAD HKACNKDPVQ ETLKYGKGSD  180
DEDVESASSS KRSTKESKRK ASAKDSSAER GENKDDSVTP KKAKVVWTNA LHNQFLEAIR  240
SIGLERAFPK KILELMNVPG LTRENVASHL QTSFSTHYVL CPQLISLDDH GIKMNLQKYR  300
IFLKRVSEAS YKIQSAAERS MIERTFRSNF TSGQPVLMHN IPGLQPFVSD QMKPPNHGNP  360
SASNQEASSS NSTLQFGSGQ SRLLCNQGNL KQPTIASAKP LYCLTSLLLD ASTSGGIISG  420
GANVTEMYQP KNQAAPKNFT NDFSKHNSAT SGFPSPDIIT HHGNIGAFNN PNLTINPNCN  480
NSNYAGYRMA RDGRLVGLGY MGAKASTDFN SNNVLITGMQ NESMSTLPLL CGNSGDHLAQ  540
GESSIGFQSG SYILPTLSNV IQQENTSALV PPTVMRHNIF GNEGESDCSF GLLNNVSNSV  600
SNSFPQPYGE CRSFSFPDQI SIQSPTQQSG GEVMVPNFGI AMTQSDEYFL TFDQNPIQAS  660
LGTMVVRVIT IVLAEGEKGF GSDVGSLVAA AAVSPARWDV LEKAISTCAG KMRPIFCGNF  720
DYDARQSDLE RLFKKYGKVD RVDMKSGFAF VYMDEERDAE DAIRGLDRMD FGRKGRRLRV  780
EWTNQERGPR RPESTKKSST NTRPSKTLFV INFDPYNTRT RDLERHFDPY GKILNVRIRR  840
NFAFIQYESQ EDAIKALDAT NMSKLMDRII SVEYAIKDDD DRRNGHSPDR SRDRSPGRRG  900
QDRGRSLSPY RRERASPDYG RGRSPSPYRR ERASPDYGRD PSPSPHRKEK TNSDHGRSPR  960
RERHSPDHVR ERSPRQRVTP DYGHGSPSPQ RERISRDNYQ RDPSPDSKHE LRDTSKYVGE  1020
DSPPHERYRS RSPLARERSR S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16221271454ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32902038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.12e-52response regulator 1